PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013637012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 639aa    MW: 69472.3 Da    PI: 7.3268
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013637012.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.62.4e-12167228162
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     e++ k+  r+ +NRe+A+ sRqRKk ++eeLeekv  + +  ++L  +++    e a+l+++
  XP_013637012.1 167 EEDEKKKARLVRNRESAQLSRQRKKHYVEELEEKVRHMHSTITDLNGKISFFMAENATLRQQ 228
                     6788999*********************************9999999999999999888886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-15167231IPR004827Basic-leucine zipper domain
PfamPF001704.7E-11168229IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.105169229IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.13E-12171229No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-16171229No hitNo description
CDDcd147044.17E-21172223No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MSQSITEEPP PPSSDSFSIP PFDDQFHHQT PIGELMSDLG FPIDGDFELT FDGMEDVYLP  60
AENETFLIPG NQEQFGDFTP ESEGSGDCLP KDADKSKSAT PLSSQGSGNC GSDVSEGTTV  120
VDQKVKVEAT TTSVTKRKKE EIEEDMSDES RNSKYRRSGE ESAVTGEEDE KKKARLVRNR  180
ESAQLSRQRK KHYVEELEEK VRHMHSTITD LNGKISFFMA ENATLRQQLG GSGMCPPPPM  240
GMYPPMAPMA YPWMPCPPYM MKQQGSQVPL IPIPRLKPQN PMGSSKGKSK KSETKTKKVA  300
SISVLGLVFC LFLFGALAPV VNVNYGGISG AFYGNYRSNY VTDQIYSQQH RNRVLDTSRS  360
SCAGSGVSNI SAPPGNGSEP LVASLFVPRN DKLVKIDGNL IINSILASEK AVASRKASES  420
SERKAADPAV VTKDYHPALP LPEVGKVEDM AKHLYRSRAQ KQRALSSGAA DTLKDQIKTK  480
AANGEMQQWF REGVAGPMFS SGMCTEVFQF DVSSTSGAII PASPAANVSA EHSKNATDTH  540
RRKNRRTLRG LPIPLPGSDF NFTKEHQRNS SSKEIKPASS MVVSVLVDPR EGGDGDIDGM  600
IGGPKSLSRV FVVVLVDSAK YVTYSCVLPR SGAPHLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013637012.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0D3BP020.0A0A0D3BP02_BRAOL; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein